gb1 dataset
[1]:
# Standard imports
import pandas as pd
import numpy as np
import matplotlib.pyplot as plt
# Special imports
import mavenn
Summary
The DMS dataset from Olson et al., 2014. The authors used an RNA display selection experiment to assay the binding of over half a million protein GB1 variants to IgG. These variants included all 1-point and 2-point mutations within the 55 residue GB1 sequence. Only the 2-point variants are included in this dataset.
Name: 'gb1'
Reference: Olson C, Wu N, Sun R. A comprehensive biophysical description of pairwise epistasis throughout an entire protein domain. Curr Biol 24(22):2643-2651 (2014).
[2]:
mavenn.load_example_dataset('gb1')
[2]:
| set | dist | input_ct | selected_ct | y | x | |
|---|---|---|---|---|---|---|
| 0 | training | 2 | 173 | 33 | -3.145154 | AAKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD... |
| 1 | training | 2 | 18 | 8 | -1.867676 | ACKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD... |
| 2 | training | 2 | 66 | 2 | -5.270800 | ADKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD... |
| 3 | training | 2 | 72 | 1 | -5.979498 | AEKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD... |
| 4 | training | 2 | 69 | 168 | 0.481923 | AFKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD... |
| ... | ... | ... | ... | ... | ... | ... |
| 530732 | training | 2 | 462 | 139 | -2.515259 | QYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD... |
| 530733 | training | 2 | 317 | 84 | -2.693165 | QYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD... |
| 530734 | training | 2 | 335 | 77 | -2.896589 | QYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD... |
| 530735 | training | 2 | 148 | 28 | -3.150861 | QYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD... |
| 530736 | training | 2 | 95 | 16 | -3.287173 | QYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD... |
530737 rows × 6 columns
Preprocessing
First we load the double-mutation dataset published by Olson et al. (2021).
[3]:
# Dataset is is at this URL:
# url = 'https://ars.els-cdn.com/content/image/1-s2.0-S0960982214012688-mmc2.xlsx'
# We have downloaded this Excel file and reformatted it into a more parseable form
raw_data_file = '../../mavenn/examples/datasets/raw/gb1_raw.xlsx'
# Load data (takes a while)
double_mut_df = pd.read_excel(raw_data_file, sheet_name='double_mutants')
double_mut_df
[3]:
| Mut1 WT amino acid | Mut1 Position | Mut1 Mutation | Mut2 WT amino acid | Mut2 Position | Mut2 Mutation | Input Count | Selection Count | Mut1 Fitness | Mut2 Fitness | |
|---|---|---|---|---|---|---|---|---|---|---|
| 0 | Q | 2 | A | Y | 3 | A | 173 | 33 | 1.518 | 0.579 |
| 1 | Q | 2 | A | Y | 3 | C | 18 | 8 | 1.518 | 0.616 |
| 2 | Q | 2 | A | Y | 3 | D | 66 | 2 | 1.518 | 0.010 |
| 3 | Q | 2 | A | Y | 3 | E | 72 | 1 | 1.518 | 0.009 |
| 4 | Q | 2 | A | Y | 3 | F | 69 | 168 | 1.518 | 1.054 |
| ... | ... | ... | ... | ... | ... | ... | ... | ... | ... | ... |
| 535912 | E | 56 | Y | T | 55 | R | 462 | 139 | 0.190 | 0.941 |
| 535913 | E | 56 | Y | T | 55 | S | 317 | 84 | 0.190 | 0.840 |
| 535914 | E | 56 | Y | T | 55 | V | 335 | 77 | 0.190 | 0.669 |
| 535915 | E | 56 | Y | T | 55 | W | 148 | 28 | 0.190 | 0.798 |
| 535916 | E | 56 | Y | T | 55 | Y | 95 | 16 | 0.190 | 0.663 |
535917 rows × 10 columns
Next we reconstruct the wild-type GB1 sequence
[4]:
# Get unique WT pos-aa associations, sorted by position
wt_1_df = double_mut_df[['Mut1 Position', 'Mut1 WT amino acid']].copy()
wt_1_df.columns = ['pos','aa']
wt_2_df = double_mut_df[['Mut2 Position', 'Mut2 WT amino acid']].copy()
wt_2_df.columns = ['pos','aa']
wt_seq_df = pd.concat([wt_1_df, wt_2_df], axis=0).drop_duplicates().sort_values(by='pos').reset_index(drop=True)
# Confirm that each position occurs at most once
assert np.all(wt_seq_df['pos'].value_counts()==1)
# Confirm that the set of unique positions is correct
L = len(wt_seq_df)
assert set(wt_seq_df['pos'].values) == set(range(2,L+2))
# Compute wt_seq and confirm its identity
wt_seq = ''.join(wt_seq_df['aa'])
known_wt_seq = 'QYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE'
assert wt_seq == known_wt_seq
# Print final wt sequence
print(f'WT sequence: {wt_seq}')
WT sequence: QYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Next we convert the list of mutations to an array x of variant sequences.
[5]:
# Introduce double mutations into WT sequence and append to a growing list
pos1s = double_mut_df['Mut1 Position'].values-2
pos2s = double_mut_df['Mut2 Position'].values-2
aa1s = double_mut_df['Mut1 Mutation'].values
aa2s = double_mut_df['Mut2 Mutation'].values
x_list = []
for pos1, aa1, pos2, aa2 in zip(pos1s, aa1s, pos2s, aa2s):
mut_seq_list = list(wt_seq)
mut_seq_list[pos1] = aa1
mut_seq_list[pos2] = aa2
mut_seq = ''.join(mut_seq_list)
x_list.append(mut_seq)
# Convert list to an np.array and preview it
x = np.array(x_list)
x
[5]:
array(['AAKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE',
'ACKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE',
'ADKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE', ...,
'QYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVVY',
'QYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVWY',
'QYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVYY'],
dtype='<U55')
We then compute the log2 enrichment y for each variant sequence in x.
[6]:
# Extract input and output counts
in_ct = double_mut_df['Input Count'].values
out_ct = double_mut_df['Selection Count'].values
# Read in wt data (on separate sheet) and compute baseline for y
wt_df = pd.read_excel(raw_data_file, sheet_name='wild_type')
wt_in_ct = wt_df['Input Count'][0]
wt_out_ct = wt_df['Selection Count'][0]
# Compute log2 enrichment values relative to WT
y = np.log2((out_ct+1)/(in_ct+1)) - np.log2((wt_out_ct+1)/(wt_in_ct+1))
y
[6]:
array([-3.14515399, -1.86767585, -5.27080003, ..., -2.89658854,
-3.15086086, -3.287173 ])
Next we assign each sequence to the training, validation, or test set using a split of 90%:5%:5%.
[7]:
# Assign to training, validation, or test set
np.random.seed(0)
sets = np.random.choice(a=['training', 'validation', 'test'],
p=[.90,.05,.05],
size=len(x))
sets
[7]:
array(['training', 'training', 'training', ..., 'training', 'training',
'training'], dtype='<U10')
Finally we assemble all relevant information into a dataframe and save.
[8]:
# Assemble into dataframe
final_df = pd.DataFrame({'set':sets, 'dist':2, 'input_ct':in_ct, 'selected_ct':out_ct, 'y':y, 'x':x})
# Keep only sequences with input_ct >= 10
final_df = final_df[final_df['input_ct']>=10].reset_index(drop=True)
# Save to file (uncomment to execute)
# final_df.to_csv('gb1_data.csv.gz', index=False, compression='gzip')
# Preview dataframe
final_df
[8]:
| set | dist | input_ct | selected_ct | y | x | |
|---|---|---|---|---|---|---|
| 0 | training | 2 | 173 | 33 | -3.145154 | AAKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD... |
| 1 | training | 2 | 18 | 8 | -1.867676 | ACKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD... |
| 2 | training | 2 | 66 | 2 | -5.270800 | ADKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD... |
| 3 | training | 2 | 72 | 1 | -5.979498 | AEKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD... |
| 4 | training | 2 | 69 | 168 | 0.481923 | AFKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD... |
| ... | ... | ... | ... | ... | ... | ... |
| 530732 | training | 2 | 462 | 139 | -2.515259 | QYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD... |
| 530733 | training | 2 | 317 | 84 | -2.693165 | QYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD... |
| 530734 | training | 2 | 335 | 77 | -2.896589 | QYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD... |
| 530735 | training | 2 | 148 | 28 | -3.150861 | QYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD... |
| 530736 | training | 2 | 95 | 16 | -3.287173 | QYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD... |
530737 rows × 6 columns